Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 653624..654423 | Replicon | chromosome |
Accession | NZ_CP121147 | ||
Organism | Escherichia coli strain E20 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | P6H07_RS03150 | Protein ID | WP_000347273.1 |
Coordinates | 653624..654088 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | P6H07_RS03155 | Protein ID | WP_001308975.1 |
Coordinates | 654088..654423 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H07_RS03120 (648625) | 648625..649059 | - | 435 | WP_000948834.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P6H07_RS03125 (649077) | 649077..649955 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P6H07_RS03130 (649945) | 649945..650724 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P6H07_RS03135 (650735) | 650735..651208 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P6H07_RS03140 (651231) | 651231..652511 | - | 1281 | WP_000681961.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P6H07_RS03145 (652760) | 652760..653569 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
P6H07_RS03150 (653624) | 653624..654088 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P6H07_RS03155 (654088) | 654088..654423 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P6H07_RS03160 (654572) | 654572..656143 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
P6H07_RS03165 (656518) | 656518..657852 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
P6H07_RS03170 (657868) | 657868..658638 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T275853 WP_000347273.1 NZ_CP121147:c654088-653624 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|