Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4993381..4993967 Replicon chromosome
Accession NZ_CP121145
Organism Klebsiella pneumoniae strain UHD-56_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T43_RS24265 Protein ID WP_002920800.1
Coordinates 4993381..4993749 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T43_RS24270 Protein ID WP_004174006.1
Coordinates 4993746..4993967 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T43_RS24245 (P8T43_24240) 4988884..4989954 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P8T43_RS24250 (P8T43_24245) 4989956..4990801 - 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T43_RS24255 (P8T43_24250) 4990798..4991685 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T43_RS24260 (P8T43_24255) 4991792..4993108 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T43_RS24265 (P8T43_24260) 4993381..4993749 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T43_RS24270 (P8T43_24265) 4993746..4993967 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T43_RS24275 (P8T43_24270) 4994131..4994844 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T43_RS24280 (P8T43_24275) 4994846..4995613 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T43_RS24285 (P8T43_24280) 4995610..4996887 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T43_RS24290 (P8T43_24285) 4996884..4997810 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4988147..5008982 20835


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275849 WP_002920800.1 NZ_CP121145:c4993749-4993381 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275849 WP_004174006.1 NZ_CP121145:c4993967-4993746 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References