Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4429690..4430276 Replicon chromosome
Accession NZ_CP121143
Organism Klebsiella pneumoniae strain UHD-57_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T33_RS21280 Protein ID WP_002920800.1
Coordinates 4429908..4430276 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T33_RS21275 Protein ID WP_004174006.1
Coordinates 4429690..4429911 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T33_RS21255 (P8T33_21250) 4425847..4426773 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P8T33_RS21260 (P8T33_21255) 4426770..4428047 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T33_RS21265 (P8T33_21260) 4428044..4428811 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T33_RS21270 (P8T33_21265) 4428813..4429526 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T33_RS21275 (P8T33_21270) 4429690..4429911 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T33_RS21280 (P8T33_21275) 4429908..4430276 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T33_RS21285 (P8T33_21280) 4430549..4431865 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T33_RS21290 (P8T33_21285) 4431972..4432859 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T33_RS21295 (P8T33_21290) 4432856..4433701 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T33_RS21300 (P8T33_21295) 4433703..4434773 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4426770..4435510 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275833 WP_002920800.1 NZ_CP121143:4429908-4430276 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275833 WP_004174006.1 NZ_CP121143:4429690-4429911 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References