275803

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4698270..4698856 Replicon chromosome
Accession NZ_CP121139
Organism Klebsiella pneumoniae strain UHD-4_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T35_RS22855 Protein ID WP_002920800.1
Coordinates 4698270..4698638 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T35_RS22860 Protein ID WP_004174006.1
Coordinates 4698635..4698856 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T35_RS22835 (P8T35_22835) 4693773..4694843 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P8T35_RS22840 (P8T35_22840) 4694845..4695690 - 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T35_RS22845 (P8T35_22845) 4695687..4696574 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T35_RS22850 (P8T35_22850) 4696681..4697997 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T35_RS22855 (P8T35_22855) 4698270..4698638 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T35_RS22860 (P8T35_22860) 4698635..4698856 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T35_RS22865 (P8T35_22865) 4699020..4699733 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T35_RS22870 (P8T35_22870) 4699735..4700502 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T35_RS22875 (P8T35_22875) 4700499..4701776 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T35_RS22880 (P8T35_22880) 4701773..4702699 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4693036..4713869 20833


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275803 WP_002920800.1 NZ_CP121139:c4698638-4698270 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275803 WP_004174006.1 NZ_CP121139:c4698856-4698635 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References