Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 4698270..4698856 | Replicon | chromosome |
Accession | NZ_CP121139 | ||
Organism | Klebsiella pneumoniae strain UHD-4_PH |
Toxin (Protein)
Gene name | doc | Uniprot ID | W8VD46 |
Locus tag | P8T35_RS22855 | Protein ID | WP_002920800.1 |
Coordinates | 4698270..4698638 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | P8T35_RS22860 | Protein ID | WP_004174006.1 |
Coordinates | 4698635..4698856 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T35_RS22835 (P8T35_22835) | 4693773..4694843 | - | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
P8T35_RS22840 (P8T35_22840) | 4694845..4695690 | - | 846 | WP_004185988.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
P8T35_RS22845 (P8T35_22845) | 4695687..4696574 | - | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
P8T35_RS22850 (P8T35_22850) | 4696681..4697997 | - | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
P8T35_RS22855 (P8T35_22855) | 4698270..4698638 | - | 369 | WP_002920800.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
P8T35_RS22860 (P8T35_22860) | 4698635..4698856 | - | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8T35_RS22865 (P8T35_22865) | 4699020..4699733 | - | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
P8T35_RS22870 (P8T35_22870) | 4699735..4700502 | - | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
P8T35_RS22875 (P8T35_22875) | 4700499..4701776 | - | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
P8T35_RS22880 (P8T35_22880) | 4701773..4702699 | - | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 4693036..4713869 | 20833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13552.92 Da Isoelectric Point: 8.6410
>T275803 WP_002920800.1 NZ_CP121139:c4698638-4698270 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GUD1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E5YJY7 |