Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4455865..4456511 | Replicon | chromosome |
Accession | NZ_CP121137 | ||
Organism | Klebsiella pneumoniae strain UHD-33_PH |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P8T49_RS21395 | Protein ID | WP_032415766.1 |
Coordinates | 4455865..4456212 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | P8T49_RS21400 | Protein ID | WP_002920557.1 |
Coordinates | 4456212..4456511 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T49_RS21385 (P8T49_21385) | 4451791..4453224 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
P8T49_RS21390 (P8T49_21390) | 4453242..4455689 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
P8T49_RS21395 (P8T49_21395) | 4455865..4456212 | + | 348 | WP_032415766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8T49_RS21400 (P8T49_21400) | 4456212..4456511 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P8T49_RS21405 (P8T49_21405) | 4456574..4458082 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
P8T49_RS21410 (P8T49_21410) | 4458287..4458616 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
P8T49_RS21415 (P8T49_21415) | 4458667..4459497 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
P8T49_RS21420 (P8T49_21420) | 4459547..4460305 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13535.49 Da Isoelectric Point: 5.2054
>T275789 WP_032415766.1 NZ_CP121137:4455865-4456212 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|