Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 891710..892296 Replicon chromosome
Accession NZ_CP121135
Organism Klebsiella pneumoniae strain UHD-41_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T41_RS04520 Protein ID WP_002920800.1
Coordinates 891710..892078 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T41_RS04525 Protein ID WP_004174006.1
Coordinates 892075..892296 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T41_RS04500 (P8T41_04500) 887213..888283 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P8T41_RS04505 (P8T41_04505) 888285..889130 - 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T41_RS04510 (P8T41_04510) 889127..890014 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T41_RS04515 (P8T41_04515) 890121..891437 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T41_RS04520 (P8T41_04520) 891710..892078 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T41_RS04525 (P8T41_04525) 892075..892296 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T41_RS04530 (P8T41_04530) 892460..893173 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T41_RS04535 (P8T41_04535) 893175..893942 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T41_RS04540 (P8T41_04540) 893939..895216 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T41_RS04545 (P8T41_04545) 895213..896139 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 886476..895216 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275764 WP_002920800.1 NZ_CP121135:c892078-891710 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275764 WP_004174006.1 NZ_CP121135:c892296-892075 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References