Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 4942346..4942932 Replicon chromosome
Accession NZ_CP121133
Organism Klebsiella pneumoniae strain UHD-45_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T31_RS24025 Protein ID WP_002920800.1
Coordinates 4942346..4942714 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T31_RS24030 Protein ID WP_004174006.1
Coordinates 4942711..4942932 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T31_RS24005 (P8T31_24005) 4937849..4938919 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P8T31_RS24010 (P8T31_24010) 4938921..4939766 - 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T31_RS24015 (P8T31_24015) 4939763..4940650 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T31_RS24020 (P8T31_24020) 4940757..4942073 - 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T31_RS24025 (P8T31_24025) 4942346..4942714 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T31_RS24030 (P8T31_24030) 4942711..4942932 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T31_RS24035 (P8T31_24035) 4943096..4943809 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T31_RS24040 (P8T31_24040) 4943811..4944578 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T31_RS24045 (P8T31_24045) 4944575..4945852 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T31_RS24050 (P8T31_24050) 4945849..4946775 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 4937112..4945852 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275759 WP_002920800.1 NZ_CP121133:c4942714-4942346 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275759 WP_004174006.1 NZ_CP121133:c4942932-4942711 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References