Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4916102..4916748 | Replicon | chromosome |
| Accession | NZ_CP121133 | ||
| Organism | Klebsiella pneumoniae strain UHD-45_PH | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P8T31_RS23915 | Protein ID | WP_032415766.1 |
| Coordinates | 4916401..4916748 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | P8T31_RS23910 | Protein ID | WP_002920557.1 |
| Coordinates | 4916102..4916401 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T31_RS23890 (P8T31_23890) | 4912308..4913066 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
| P8T31_RS23895 (P8T31_23895) | 4913116..4913946 | - | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| P8T31_RS23900 (P8T31_23900) | 4913997..4914326 | - | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| P8T31_RS23905 (P8T31_23905) | 4914531..4916039 | + | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| P8T31_RS23910 (P8T31_23910) | 4916102..4916401 | - | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P8T31_RS23915 (P8T31_23915) | 4916401..4916748 | - | 348 | WP_032415766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T31_RS23920 (P8T31_23920) | 4916924..4919371 | - | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| P8T31_RS23925 (P8T31_23925) | 4919389..4920822 | - | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13535.49 Da Isoelectric Point: 5.2054
>T275758 WP_032415766.1 NZ_CP121133:c4916748-4916401 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|