Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 3897022..3897668 | Replicon | chromosome |
| Accession | NZ_CP121131 | ||
| Organism | Klebsiella pneumoniae strain UHD-50_PH | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P8T45_RS18790 | Protein ID | WP_032415766.1 |
| Coordinates | 3897022..3897369 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | P8T45_RS18795 | Protein ID | WP_002920557.1 |
| Coordinates | 3897369..3897668 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T45_RS18780 (P8T45_18785) | 3892948..3894381 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| P8T45_RS18785 (P8T45_18790) | 3894399..3896846 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| P8T45_RS18790 (P8T45_18795) | 3897022..3897369 | + | 348 | WP_032415766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8T45_RS18795 (P8T45_18800) | 3897369..3897668 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P8T45_RS18800 (P8T45_18805) | 3897731..3899239 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| P8T45_RS18805 (P8T45_18810) | 3899444..3899773 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| P8T45_RS18810 (P8T45_18815) | 3899824..3900654 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| P8T45_RS18815 (P8T45_18820) | 3900704..3901462 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13535.49 Da Isoelectric Point: 5.2054
>T275744 WP_032415766.1 NZ_CP121131:3897022-3897369 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|