Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3870838..3871424 Replicon chromosome
Accession NZ_CP121131
Organism Klebsiella pneumoniae strain UHD-50_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T45_RS18680 Protein ID WP_002920800.1
Coordinates 3871056..3871424 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T45_RS18675 Protein ID WP_004174006.1
Coordinates 3870838..3871059 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T45_RS18655 (P8T45_18660) 3866995..3867921 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P8T45_RS18660 (P8T45_18665) 3867918..3869195 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T45_RS18665 (P8T45_18670) 3869192..3869959 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T45_RS18670 (P8T45_18675) 3869961..3870674 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T45_RS18675 (P8T45_18680) 3870838..3871059 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T45_RS18680 (P8T45_18685) 3871056..3871424 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T45_RS18685 (P8T45_18690) 3871697..3873013 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T45_RS18690 (P8T45_18695) 3873120..3874007 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T45_RS18695 (P8T45_18700) 3874004..3874849 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T45_RS18700 (P8T45_18705) 3874851..3875921 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3867918..3876658 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275743 WP_002920800.1 NZ_CP121131:3871056-3871424 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275743 WP_004174006.1 NZ_CP121131:3870838-3871059 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References