Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 5271961..5272547 Replicon chromosome
Accession NZ_CP121127
Organism Klebsiella pneumoniae strain UHD-53_PH

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P8T39_RS25585 Protein ID WP_002920800.1
Coordinates 5272179..5272547 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P8T39_RS25580 Protein ID WP_004174006.1
Coordinates 5271961..5272182 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T39_RS25560 (P8T39_25560) 5268118..5269044 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P8T39_RS25565 (P8T39_25565) 5269041..5270318 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P8T39_RS25570 (P8T39_25570) 5270315..5271082 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8T39_RS25575 (P8T39_25575) 5271084..5271797 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8T39_RS25580 (P8T39_25580) 5271961..5272182 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8T39_RS25585 (P8T39_25585) 5272179..5272547 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8T39_RS25590 (P8T39_25590) 5272820..5274136 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8T39_RS25595 (P8T39_25595) 5274243..5275130 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8T39_RS25600 (P8T39_25600) 5275127..5275972 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8T39_RS25605 (P8T39_25605) 5275974..5277044 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 5269041..5277781 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275714 WP_002920800.1 NZ_CP121127:5272179-5272547 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275714 WP_004174006.1 NZ_CP121127:5271961-5272182 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References