Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 575101..575939 | Replicon | plasmid unnamed |
| Accession | NZ_CP121109 | ||
| Organism | Pantoea sp. X85 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | P6287_RS22245 | Protein ID | WP_277975061.1 |
| Coordinates | 575101..575583 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | P6287_RS22250 | Protein ID | WP_277975062.1 |
| Coordinates | 575601..575939 (-) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6287_RS22225 (P6287_22225) | 570388..571350 | + | 963 | WP_277975348.1 | ABC transporter substrate-binding protein | - |
| P6287_RS22230 (P6287_22230) | 571358..572773 | + | 1416 | WP_277975058.1 | amidohydrolase family protein | - |
| P6287_RS22235 (P6287_22235) | 572779..574299 | - | 1521 | WP_277975059.1 | MDR family MFS transporter | - |
| P6287_RS22240 (P6287_22240) | 574379..575044 | + | 666 | WP_277975060.1 | TetR/AcrR family transcriptional regulator | - |
| P6287_RS22245 (P6287_22245) | 575101..575583 | - | 483 | WP_277975061.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| P6287_RS22250 (P6287_22250) | 575601..575939 | - | 339 | WP_277975062.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| P6287_RS22255 (P6287_22255) | 576155..576721 | + | 567 | WP_277975063.1 | peroxiredoxin | - |
| P6287_RS22260 (P6287_22260) | 576737..577966 | + | 1230 | WP_192413167.1 | thioredoxin family protein | - |
| P6287_RS22265 (P6287_22265) | 577984..578541 | + | 558 | WP_192413169.1 | sigma-70 family RNA polymerase sigma factor | - |
| P6287_RS22270 (P6287_22270) | 578528..579157 | + | 630 | WP_277975064.1 | NrsF family protein | - |
| P6287_RS22275 (P6287_22275) | 579320..579589 | + | 270 | WP_101761698.1 | DUF1471 family periplasmic protein YahO | - |
| P6287_RS22280 (P6287_22280) | 579757..580824 | - | 1068 | WP_277975065.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..771939 | 771939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 18802.44 Da Isoelectric Point: 9.2890
>T275696 WP_277975061.1 NZ_CP121109:c575583-575101 [Pantoea sp. X85]
VDYMEINGWKFYFHACFSAQVTSLAQEVLQLRVEKPHEYHKKKQTKLLAAIYKVVTEVIARDPLNPQFRQGGTLGDENRY
WFRAKFLQQFRLFFRCSEQSKTIILGWVNDFGTLRAYESKTDAYKTFKRMLDAGHPPSDWEQLLRESTGESGFLFQAPFS
VDYMEINGWKFYFHACFSAQVTSLAQEVLQLRVEKPHEYHKKKQTKLLAAIYKVVTEVIARDPLNPQFRQGGTLGDENRY
WFRAKFLQQFRLFFRCSEQSKTIILGWVNDFGTLRAYESKTDAYKTFKRMLDAGHPPSDWEQLLRESTGESGFLFQAPFS
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|