Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
Location | 18464..19115 | Replicon | plasmid unnamed |
Accession | NZ_CP121109 | ||
Organism | Pantoea sp. X85 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P6287_RS19800 | Protein ID | WP_137387145.1 |
Coordinates | 18464..18808 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P6287_RS19805 | Protein ID | WP_210080109.1 |
Coordinates | 18801..19115 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6287_RS19785 (P6287_19785) | 14099..15538 | + | 1440 | WP_271460188.1 | MFS transporter | - |
P6287_RS19790 (P6287_19790) | 15535..16749 | + | 1215 | WP_277975160.1 | acyl-CoA dehydrogenase family protein | - |
P6287_RS19800 (P6287_19800) | 18464..18808 | + | 345 | WP_137387145.1 | toxin | Toxin |
P6287_RS19805 (P6287_19805) | 18801..19115 | + | 315 | WP_210080109.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
P6287_RS19810 (P6287_19810) | 19250..20197 | - | 948 | WP_277975162.1 | sulfonate ABC transporter substrate-binding protein | - |
P6287_RS19815 (P6287_19815) | 20452..22509 | + | 2058 | WP_277975163.1 | FUSC family protein | - |
P6287_RS19820 (P6287_19820) | 22525..23214 | + | 690 | WP_192414671.1 | aspartate/glutamate racemase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | hcp/tssD | 1..771939 | 771939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13492.32 Da Isoelectric Point: 9.9070
>T275694 WP_137387145.1 NZ_CP121109:18464-18808 [Pantoea sp. X85]
MHATFIELSSFQKYRVEYLSDDQFRLFQNMLMADPEKGDVIPDTGGLRKVRFRDERRNKGTRGGIRVIYYWTNEKGQFIL
FTIYDKDQRDDLTKQQRDALGSALNVIKKGLRHD
MHATFIELSSFQKYRVEYLSDDQFRLFQNMLMADPEKGDVIPDTGGLRKVRFRDERRNKGTRGGIRVIYYWTNEKGQFIL
FTIYDKDQRDDLTKQQRDALGSALNVIKKGLRHD
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|