Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3933691..3934375 | Replicon | chromosome |
Accession | NZ_CP121108 | ||
Organism | Pantoea sp. X85 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | P6287_RS18340 | Protein ID | WP_277974209.1 |
Coordinates | 3934043..3934375 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P6287_RS18335 | Protein ID | WP_101762746.1 |
Coordinates | 3933691..3934023 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6287_RS18320 (P6287_18320) | 3930493..3932172 | - | 1680 | WP_277974208.1 | potassium-transporting ATPase subunit KdpA | - |
P6287_RS18325 (P6287_18325) | 3932172..3932261 | - | 90 | WP_081113208.1 | K(+)-transporting ATPase subunit F | - |
P6287_RS18330 (P6287_18330) | 3932371..3933534 | - | 1164 | WP_192236933.1 | HD-GYP domain-containing protein | - |
P6287_RS18335 (P6287_18335) | 3933691..3934023 | - | 333 | WP_101762746.1 | HigA family addiction module antitoxin | Antitoxin |
P6287_RS18340 (P6287_18340) | 3934043..3934375 | - | 333 | WP_277974209.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6287_RS18345 (P6287_18345) | 3934499..3935890 | - | 1392 | WP_277974210.1 | MFS transporter | - |
P6287_RS18350 (P6287_18350) | 3936303..3937217 | + | 915 | WP_277974211.1 | sugar ABC transporter substrate-binding protein | - |
P6287_RS18355 (P6287_18355) | 3937298..3937792 | - | 495 | WP_277974212.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 13063.00 Da Isoelectric Point: 9.9849
>T275693 WP_277974209.1 NZ_CP121108:c3934375-3934043 [Pantoea sp. X85]
MKGSIHSFRDDWLRLFFVYATPHKHIPAMIESALARKLDIIHAATSHHDLRSPPGNRFEALRPPLLGYYSIRINEQYRLI
FQWVNGTARDYYLDPHTYRKHRYQPLVANC
MKGSIHSFRDDWLRLFFVYATPHKHIPAMIESALARKLDIIHAATSHHDLRSPPGNRFEALRPPLLGYYSIRINEQYRLI
FQWVNGTARDYYLDPHTYRKHRYQPLVANC
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|