Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 484353..484938 | Replicon | chromosome |
| Accession | NZ_CP121108 | ||
| Organism | Pantoea sp. X85 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P6287_RS02150 | Protein ID | WP_277974900.1 |
| Coordinates | 484353..484652 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P6287_RS02155 | Protein ID | WP_008109607.1 |
| Coordinates | 484639..484938 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6287_RS02130 (P6287_02130) | 480252..480962 | - | 711 | WP_137385029.1 | 5-oxoprolinase subunit PxpB | - |
| P6287_RS02135 (P6287_02135) | 480965..481804 | - | 840 | WP_277974434.1 | transporter substrate-binding domain-containing protein | - |
| P6287_RS02140 (P6287_02140) | 482075..482995 | + | 921 | WP_277974435.1 | DMT family transporter | - |
| P6287_RS02145 (P6287_02145) | 483130..483825 | - | 696 | WP_101762304.1 | RraA family protein | - |
| P6287_RS02150 (P6287_02150) | 484353..484652 | + | 300 | WP_277974900.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P6287_RS02155 (P6287_02155) | 484639..484938 | + | 300 | WP_008109607.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P6287_RS02165 (P6287_02165) | 485211..485789 | - | 579 | WP_101762303.1 | transcriptional regulator | - |
| P6287_RS02170 (P6287_02170) | 485856..487556 | - | 1701 | WP_277974436.1 | protein-disulfide reductase DsbD | - |
| P6287_RS02175 (P6287_02175) | 487640..488941 | - | 1302 | WP_101762301.1 | anaerobic C4-dicarboxylate transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11229.07 Da Isoelectric Point: 9.9714
>T275688 WP_277974900.1 NZ_CP121108:484353-484652 [Pantoea sp. X85]
MVEDVLSSLELLKVFGPMLGRPDVDTVTGSRFANMKELRVQSNGRPIRAFFAFDPVRKAIVLCAGDKTGVNQKRFYQSMI
KLADKEYKQHLEELTHAKT
MVEDVLSSLELLKVFGPMLGRPDVDTVTGSRFANMKELRVQSNGRPIRAFFAFDPVRKAIVLCAGDKTGVNQKRFYQSMI
KLADKEYKQHLEELTHAKT
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|