Detailed information of TA system TA275681

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 117424..117845
• Replicon: plasmid p167kb
• Accession: NZ_CP121088
• Organism: Escherichia coli strain ST3

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P5670_RS24600
• Protein ID: WP_096937776.1
• Coordinates: 117424..117549 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	117647..117845 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P5670_RS24560 (112489)	112489..112704	-	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-
P5670_RS24565 (112840)	112840..113487	-	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
P5670_RS24570 (113679)	113679..114062	-	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P5670_RS24575 (114402)	114402..115004	+	603	WP_077248356.1	transglycosylase SLT domain-containing protein	-
P5670_RS24580 (115299)	115299..116120	-	822	WP_001234475.1	DUF932 domain-containing protein	-
P5670_RS24585 (116239)	116239..116526	-	288	WP_000107546.1	hypothetical protein	-
P5670_RS24590 (116551)	116551..116757	-	207	WP_000547965.1	hypothetical protein	-
P5670_RS24595 (116827)	116827..117123	+	297	Protein_121	hypothetical protein	-
P5670_RS24600 (117424)	117424..117549	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
P5670_RS24605 (117491)	117491..117640	-	150	Protein_123	DUF5431 family protein	-
- (117647)	117647..117845	-	199	NuclAT_0	-	Antitoxin
- (117647)	117647..117845	-	199	NuclAT_0	-	Antitoxin
- (117647)	117647..117845	-	199	NuclAT_0	-	Antitoxin
- (117647)	117647..117845	-	199	NuclAT_0	-	Antitoxin
P5670_RS24610 (117814)	117814..118576	-	763	Protein_124	plasmid SOS inhibition protein A	-
P5670_RS24615 (118573)	118573..119007	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
P5670_RS24620 (119062)	119062..121020	-	1959	WP_029487628.1	ParB/RepB/Spo0J family partition protein	-
P5670_RS24625 (121086)	121086..121319	-	234	WP_000005990.1	DUF905 family protein	-
P5670_RS24630 (121376)	121376..121915	-	540	WP_000290801.1	single-stranded DNA-binding protein	-
P5670_RS24635 (122233)	122233..122742	+	510	WP_071600123.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / qnrS1 / blaTEM-1B / sitABCD	iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA	1..167740	167740

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T275681 WP_096937776.1 NZ_CP121088:c117549-117424 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT275681 NZ_CP121088:c117845-117647 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin