Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79270..79524 | Replicon | plasmid p167kb |
| Accession | NZ_CP121088 | ||
| Organism | Escherichia coli strain ST3 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | P5670_RS24370 | Protein ID | WP_001312851.1 |
| Coordinates | 79270..79419 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79463..79524 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5670_RS24340 (74552) | 74552..77557 | + | 3006 | WP_001143760.1 | Tn3-like element Tn3 family transposase | - |
| P5670_RS24345 (77490) | 77490..77955 | - | 466 | Protein_71 | plasmid replication initiator RepA | - |
| P5670_RS24350 (77948) | 77948..78430 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| P5670_RS24355 (78423) | 78423..78470 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| P5670_RS24360 (78461) | 78461..78712 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| P5670_RS24365 (78729) | 78729..78986 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| P5670_RS24370 (79270) | 79270..79419 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79463) | 79463..79524 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79463) | 79463..79524 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79463) | 79463..79524 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (79463) | 79463..79524 | + | 62 | NuclAT_1 | - | Antitoxin |
| P5670_RS24375 (79780) | 79780..79854 | - | 75 | Protein_77 | endonuclease | - |
| P5670_RS24380 (80100) | 80100..80312 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| P5670_RS24385 (80448) | 80448..81008 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| P5670_RS24390 (81111) | 81111..81971 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| P5670_RS24395 (82030) | 82030..82776 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / qnrS1 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iucA / iucB / iucC / iucD / iutA | 1..167740 | 167740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T275679 WP_001312851.1 NZ_CP121088:c79419-79270 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT275679 NZ_CP121088:79463-79524 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
