Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3889820..3890513 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | P5670_RS19000 | Protein ID | WP_000415584.1 |
Coordinates | 3889820..3890116 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | P5670_RS19005 | Protein ID | WP_000650107.1 |
Coordinates | 3890118..3890513 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS18965 (3884899) | 3884899..3885213 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
P5670_RS18970 (3885244) | 3885244..3885825 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
P5670_RS18975 (3886153) | 3886153..3886485 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
P5670_RS18980 (3886531) | 3886531..3887880 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
P5670_RS18985 (3887877) | 3887877..3888536 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
P5670_RS18990 (3888688) | 3888688..3889080 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
P5670_RS18995 (3889133) | 3889133..3889615 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
P5670_RS19000 (3889820) | 3889820..3890116 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
P5670_RS19005 (3890118) | 3890118..3890513 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
P5670_RS19010 (3890646) | 3890646..3892253 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
P5670_RS19015 (3892391) | 3892391..3894649 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T275676 WP_000415584.1 NZ_CP121087:3889820-3890116 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT275676 WP_000650107.1 NZ_CP121087:3890118-3890513 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|