Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3784067..3784866 | Replicon | chromosome |
Accession | NZ_CP121087 | ||
Organism | Escherichia coli strain ST3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | B7NDB6 |
Locus tag | P5670_RS18475 | Protein ID | WP_000347269.1 |
Coordinates | 3784067..3784531 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0YUB5 |
Locus tag | P5670_RS18480 | Protein ID | WP_001309780.1 |
Coordinates | 3784531..3784866 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5670_RS18445 (3779068) | 3779068..3779502 | - | 435 | WP_000948818.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
P5670_RS18450 (3779520) | 3779520..3780398 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
P5670_RS18455 (3780388) | 3780388..3781167 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
P5670_RS18460 (3781178) | 3781178..3781651 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
P5670_RS18465 (3781674) | 3781674..3782954 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
P5670_RS18470 (3783203) | 3783203..3784012 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
P5670_RS18475 (3784067) | 3784067..3784531 | - | 465 | WP_000347269.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
P5670_RS18480 (3784531) | 3784531..3784866 | - | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
P5670_RS18485 (3785015) | 3785015..3786586 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
P5670_RS18490 (3786961) | 3786961..3788295 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
P5670_RS18495 (3788311) | 3788311..3789081 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3784067..3795235 | 11168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T275674 WP_000347269.1 NZ_CP121087:c3784531-3784067 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829IY86 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0YUB5 |