Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
| Location | 2418774..2419186 | Replicon | chromosome |
| Accession | NZ_CP121087 | ||
| Organism | Escherichia coli strain ST3 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | U9YSY7 |
| Locus tag | P5670_RS11955 | Protein ID | WP_000132601.1 |
| Coordinates | 2418845..2419186 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 2418774..2418850 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5670_RS11945 (2415637) | 2415637..2417226 | + | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
| P5670_RS11950 (2417223) | 2417223..2418617 | + | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_12 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_13 | - | Antitoxin |
| - (2418774) | 2418774..2418850 | - | 77 | NuclAT_13 | - | Antitoxin |
| P5670_RS11955 (2418845) | 2418845..2419186 | + | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
| P5670_RS11960 (2419348) | 2419348..2420727 | + | 1380 | WP_032148299.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| P5670_RS11965 (2420727) | 2420727..2421773 | + | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2417223..2432140 | 14917 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T275665 WP_000132601.1 NZ_CP121087:2418845-2419186 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT275665 NZ_CP121087:c2418850-2418774 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|