Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2332622..2332880 | Replicon | chromosome |
| Accession | NZ_CP121087 | ||
| Organism | Escherichia coli strain ST3 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | P5670_RS11535 | Protein ID | WP_000809168.1 |
| Coordinates | 2332728..2332880 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 2332622..2332679 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5670_RS11520 | 2329014..2329973 | + | 960 | WP_000871674.1 | hypothetical protein | - |
| P5670_RS11525 | 2330011..2330910 | - | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| P5670_RS11530 | 2330976..2332142 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 2332622..2332679 | - | 58 | - | - | Antitoxin |
| P5670_RS11535 | 2332728..2332880 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| P5670_RS11540 | 2332984..2334114 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| P5670_RS11545 | 2334203..2336119 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| P5670_RS11550 | 2336495..2336899 | + | 405 | WP_000843584.1 | DUF2541 family protein | - |
| P5670_RS11555 | 2336925..2337638 | + | 714 | WP_001102367.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T275664 WP_000809168.1 NZ_CP121087:2332728-2332880 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT275664 NZ_CP121087:c2332679-2332622 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
