Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2034306..2034956 | Replicon | chromosome |
| Accession | NZ_CP121087 | ||
| Organism | Escherichia coli strain ST3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | P5670_RS10170 | Protein ID | WP_000263532.1 |
| Coordinates | 2034615..2034956 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | U9YXQ7 |
| Locus tag | P5670_RS10165 | Protein ID | WP_000212552.1 |
| Coordinates | 2034306..2034605 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5670_RS10140 (2029754) | 2029754..2030065 | - | 312 | WP_000415004.1 | hypothetical protein | - |
| P5670_RS10145 (2030070) | 2030070..2030462 | - | 393 | WP_000285322.1 | flagellar export chaperone FliS | - |
| P5670_RS10150 (2030485) | 2030485..2031801 | - | 1317 | WP_000609678.1 | flagellar filament capping protein FliD | - |
| P5670_RS10155 (2032006) | 2032006..2032920 | - | 915 | WP_000949083.1 | lateral flagellin LafA | - |
| P5670_RS10160 (2033406) | 2033406..2034248 | + | 843 | WP_000022366.1 | winged helix-turn-helix domain-containing protein | - |
| P5670_RS10165 (2034306) | 2034306..2034605 | - | 300 | WP_000212552.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P5670_RS10170 (2034615) | 2034615..2034956 | - | 342 | WP_000263532.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P5670_RS10175 (2035032) | 2035032..2036009 | - | 978 | WP_001195938.1 | hypothetical protein | - |
| P5670_RS10180 (2036026) | 2036026..2036955 | - | 930 | WP_001266799.1 | flagellar hook-associated protein FlgL | - |
| P5670_RS10185 (2036970) | 2036970..2038346 | - | 1377 | WP_000367245.1 | flagellar hook-associated protein FlgK | - |
| P5670_RS10190 (2038522) | 2038522..2038821 | - | 300 | WP_000867281.1 | rod-binding protein | - |
| P5670_RS10195 (2038821) | 2038821..2039921 | - | 1101 | WP_001181876.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2024015..2034959 | 10944 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13031.86 Da Isoelectric Point: 6.4677
>T275663 WP_000263532.1 NZ_CP121087:c2034956-2034615 [Escherichia coli]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|