Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4660962..4661716 | Replicon | chromosome |
| Accession | NZ_CP121076 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P8I06_RS22750 | Protein ID | WP_000558166.1 |
| Coordinates | 4660962..4661273 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8I06_RS22755 | Protein ID | WP_001259011.1 |
| Coordinates | 4661270..4661716 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I06_RS22720 (4656620) | 4656620..4657522 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P8I06_RS22725 (4657519) | 4657519..4658154 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8I06_RS22730 (4658151) | 4658151..4659080 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P8I06_RS22735 (4659127) | 4659127..4659417 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P8I06_RS22740 (4659418) | 4659418..4659729 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P8I06_RS22745 (4659947) | 4659947..4660876 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P8I06_RS22750 (4660962) | 4660962..4661273 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P8I06_RS22755 (4661270) | 4661270..4661716 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P8I06_RS22760 (4661731) | 4661731..4662672 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P8I06_RS22765 (4662717) | 4662717..4663154 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| P8I06_RS22770 (4663151) | 4663151..4664023 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P8I06_RS22775 (4664017) | 4664017..4664616 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
| P8I06_RS22780 (4664807) | 4664807..4665610 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P8I06_RS22785 (4665644) | 4665644..4666540 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T275648 WP_000558166.1 NZ_CP121076:4660962-4661273 [Salmonella enterica subsp. enterica serovar Infantis]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT275648 WP_001259011.1 NZ_CP121076:4661270-4661716 [Salmonella enterica subsp. enterica serovar Infantis]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|