Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1603815..1604079 Replicon chromosome
Accession NZ_CP121076
Organism Salmonella enterica subsp. enterica serovar Infantis strain R22.3740

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag P8I06_RS07745 Protein ID WP_001387489.1
Coordinates 1603927..1604079 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 1603815..1603875 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I06_RS07730 (1599917) 1599917..1600987 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
P8I06_RS07735 (1601006) 1601006..1602214 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
P8I06_RS07740 (1602521) 1602521..1603300 - 780 WP_275450201.1 protein FinQ -
- (1603815) 1603815..1603875 - 61 NuclAT_1 - Antitoxin
- (1603815) 1603815..1603875 - 61 NuclAT_1 - Antitoxin
- (1603815) 1603815..1603875 - 61 NuclAT_1 - Antitoxin
- (1603815) 1603815..1603875 - 61 NuclAT_1 - Antitoxin
P8I06_RS07745 (1603927) 1603927..1604079 + 153 WP_001387489.1 Hok/Gef family protein Toxin
P8I06_RS07750 (1604151) 1604151..1604402 - 252 WP_001291964.1 hypothetical protein -
P8I06_RS07755 (1604903) 1604903..1604998 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
P8I06_RS07760 (1605063) 1605063..1605239 - 177 WP_001054897.1 hypothetical protein -
P8I06_RS07765 (1605631) 1605631..1605840 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
P8I06_RS07770 (1605912) 1605912..1606574 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
P8I06_RS07775 (1606645) 1606645..1608813 - 2169 WP_058649949.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-65 - 1541233..1642804 101571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T275637 WP_001387489.1 NZ_CP121076:1603927-1604079 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT275637 NZ_CP121076:c1603875-1603815 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References