Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1603815..1604079 | Replicon | chromosome |
| Accession | NZ_CP121076 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | P8I06_RS07745 | Protein ID | WP_001387489.1 |
| Coordinates | 1603927..1604079 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 1603815..1603875 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I06_RS07730 (1599917) | 1599917..1600987 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| P8I06_RS07735 (1601006) | 1601006..1602214 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
| P8I06_RS07740 (1602521) | 1602521..1603300 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (1603815) | 1603815..1603875 | - | 61 | NuclAT_1 | - | Antitoxin |
| - (1603815) | 1603815..1603875 | - | 61 | NuclAT_1 | - | Antitoxin |
| - (1603815) | 1603815..1603875 | - | 61 | NuclAT_1 | - | Antitoxin |
| - (1603815) | 1603815..1603875 | - | 61 | NuclAT_1 | - | Antitoxin |
| P8I06_RS07745 (1603927) | 1603927..1604079 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| P8I06_RS07750 (1604151) | 1604151..1604402 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| P8I06_RS07755 (1604903) | 1604903..1604998 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| P8I06_RS07760 (1605063) | 1605063..1605239 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| P8I06_RS07765 (1605631) | 1605631..1605840 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| P8I06_RS07770 (1605912) | 1605912..1606574 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| P8I06_RS07775 (1606645) | 1606645..1608813 | - | 2169 | WP_058649949.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaCTX-M-65 | - | 1541233..1642804 | 101571 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T275637 WP_001387489.1 NZ_CP121076:1603927-1604079 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT275637 NZ_CP121076:c1603875-1603815 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|