Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 138781..139383 | Replicon | chromosome |
| Accession | NZ_CP121075 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2574 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | P8I05_RS00705 | Protein ID | WP_001159630.1 |
| Coordinates | 139072..139383 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8I05_RS00700 | Protein ID | WP_000362050.1 |
| Coordinates | 138781..139071 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I05_RS00685 (136274) | 136274..137176 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P8I05_RS00690 (137173) | 137173..137808 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8I05_RS00695 (137805) | 137805..138734 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P8I05_RS00700 (138781) | 138781..139071 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| P8I05_RS00705 (139072) | 139072..139383 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| P8I05_RS00710 (139601) | 139601..140530 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P8I05_RS00715 (140616) | 140616..140927 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| P8I05_RS00720 (140924) | 140924..141370 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| P8I05_RS00725 (141385) | 141385..142326 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P8I05_RS00730 (142371) | 142371..142808 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| P8I05_RS00735 (142805) | 142805..143677 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P8I05_RS00740 (143671) | 143671..144270 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T275617 WP_001159630.1 NZ_CP121075:c139383-139072 [Salmonella enterica subsp. enterica serovar Infantis]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT275617 WP_000362050.1 NZ_CP121075:c139071-138781 [Salmonella enterica subsp. enterica serovar Infantis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|