Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4661364..4662118 | Replicon | chromosome |
| Accession | NZ_CP121073 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2169 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P8I07_RS22755 | Protein ID | WP_000558166.1 |
| Coordinates | 4661364..4661675 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8I07_RS22760 | Protein ID | WP_001259011.1 |
| Coordinates | 4661672..4662118 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I07_RS22725 (4657022) | 4657022..4657924 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P8I07_RS22730 (4657921) | 4657921..4658556 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8I07_RS22735 (4658553) | 4658553..4659482 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P8I07_RS22740 (4659529) | 4659529..4659819 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P8I07_RS22745 (4659820) | 4659820..4660131 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P8I07_RS22750 (4660349) | 4660349..4661278 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P8I07_RS22755 (4661364) | 4661364..4661675 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P8I07_RS22760 (4661672) | 4661672..4662118 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P8I07_RS22765 (4662133) | 4662133..4663074 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P8I07_RS22770 (4663119) | 4663119..4663556 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| P8I07_RS22775 (4663553) | 4663553..4664425 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P8I07_RS22780 (4664419) | 4664419..4665018 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
| P8I07_RS22785 (4665209) | 4665209..4666012 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P8I07_RS22790 (4666046) | 4666046..4666942 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T275612 WP_000558166.1 NZ_CP121073:4661364-4661675 [Salmonella enterica subsp. enterica serovar Infantis]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT275612 WP_001259011.1 NZ_CP121073:4661672-4662118 [Salmonella enterica subsp. enterica serovar Infantis]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|