Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4661607..4662361 | Replicon | chromosome |
| Accession | NZ_CP121070 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P8I10_RS22745 | Protein ID | WP_000558166.1 |
| Coordinates | 4661607..4661918 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8I10_RS22750 | Protein ID | WP_001259011.1 |
| Coordinates | 4661915..4662361 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I10_RS22715 (4657265) | 4657265..4658167 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| P8I10_RS22720 (4658164) | 4658164..4658799 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P8I10_RS22725 (4658796) | 4658796..4659725 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| P8I10_RS22730 (4659772) | 4659772..4660062 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P8I10_RS22735 (4660063) | 4660063..4660374 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P8I10_RS22740 (4660592) | 4660592..4661521 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
| P8I10_RS22745 (4661607) | 4661607..4661918 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P8I10_RS22750 (4661915) | 4661915..4662361 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P8I10_RS22755 (4662376) | 4662376..4663317 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P8I10_RS22760 (4663362) | 4663362..4663799 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
| P8I10_RS22765 (4663796) | 4663796..4664668 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P8I10_RS22770 (4664662) | 4664662..4665261 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
| P8I10_RS22775 (4665452) | 4665452..4666255 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P8I10_RS22780 (4666289) | 4666289..4667185 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T275591 WP_000558166.1 NZ_CP121070:4661607-4661918 [Salmonella enterica subsp. enterica serovar Infantis]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT275591 WP_001259011.1 NZ_CP121070:4661915-4662361 [Salmonella enterica subsp. enterica serovar Infantis]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|