Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4659772..4660374 | Replicon | chromosome |
Accession | NZ_CP121070 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | P8I10_RS22735 | Protein ID | WP_001159630.1 |
Coordinates | 4660063..4660374 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P8I10_RS22730 | Protein ID | WP_000362050.1 |
Coordinates | 4659772..4660062 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I10_RS22715 (4657265) | 4657265..4658167 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
P8I10_RS22720 (4658164) | 4658164..4658799 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
P8I10_RS22725 (4658796) | 4658796..4659725 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
P8I10_RS22730 (4659772) | 4659772..4660062 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
P8I10_RS22735 (4660063) | 4660063..4660374 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
P8I10_RS22740 (4660592) | 4660592..4661521 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
P8I10_RS22745 (4661607) | 4661607..4661918 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
P8I10_RS22750 (4661915) | 4661915..4662361 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
P8I10_RS22755 (4662376) | 4662376..4663317 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
P8I10_RS22760 (4663362) | 4663362..4663799 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
P8I10_RS22765 (4663796) | 4663796..4664668 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
P8I10_RS22770 (4664662) | 4664662..4665261 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T275590 WP_001159630.1 NZ_CP121070:c4660374-4660063 [Salmonella enterica subsp. enterica serovar Infantis]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT275590 WP_000362050.1 NZ_CP121070:c4660062-4659772 [Salmonella enterica subsp. enterica serovar Infantis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|