Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1604704..1604968 | Replicon | chromosome |
Accession | NZ_CP121070 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | P8I10_RS07750 | Protein ID | WP_001387489.1 |
Coordinates | 1604816..1604968 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 1604704..1604764 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I10_RS07735 (1600806) | 1600806..1601876 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
P8I10_RS07740 (1601895) | 1601895..1603103 | - | 1209 | WP_001383960.1 | IncI1-type conjugal transfer protein TrbA | - |
P8I10_RS07745 (1603410) | 1603410..1604189 | - | 780 | WP_275450201.1 | protein FinQ | - |
- (1604704) | 1604704..1604764 | - | 61 | NuclAT_1 | - | Antitoxin |
- (1604704) | 1604704..1604764 | - | 61 | NuclAT_1 | - | Antitoxin |
- (1604704) | 1604704..1604764 | - | 61 | NuclAT_1 | - | Antitoxin |
- (1604704) | 1604704..1604764 | - | 61 | NuclAT_1 | - | Antitoxin |
P8I10_RS07750 (1604816) | 1604816..1604968 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
P8I10_RS07755 (1605040) | 1605040..1605291 | - | 252 | WP_001291964.1 | hypothetical protein | - |
P8I10_RS07760 (1605792) | 1605792..1605887 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
P8I10_RS07765 (1605952) | 1605952..1606128 | - | 177 | WP_001054897.1 | hypothetical protein | - |
P8I10_RS07770 (1606520) | 1606520..1606729 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
P8I10_RS07775 (1606801) | 1606801..1607463 | - | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
P8I10_RS07780 (1607534) | 1607534..1609702 | - | 2169 | WP_058649949.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaCTX-M-65 | - | 1541294..1643693 | 102399 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T275580 WP_001387489.1 NZ_CP121070:1604816-1604968 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T275580 NZ_CP121070:1604816-1604968 [Salmonella enterica subsp. enterica serovar Infantis]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT275580 NZ_CP121070:c1604764-1604704 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|