Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1604704..1604968 Replicon chromosome
Accession NZ_CP121070
Organism Salmonella enterica subsp. enterica serovar Infantis strain R22.0044

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag P8I10_RS07750 Protein ID WP_001387489.1
Coordinates 1604816..1604968 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 1604704..1604764 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I10_RS07735 (1600806) 1600806..1601876 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
P8I10_RS07740 (1601895) 1601895..1603103 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
P8I10_RS07745 (1603410) 1603410..1604189 - 780 WP_275450201.1 protein FinQ -
- (1604704) 1604704..1604764 - 61 NuclAT_1 - Antitoxin
- (1604704) 1604704..1604764 - 61 NuclAT_1 - Antitoxin
- (1604704) 1604704..1604764 - 61 NuclAT_1 - Antitoxin
- (1604704) 1604704..1604764 - 61 NuclAT_1 - Antitoxin
P8I10_RS07750 (1604816) 1604816..1604968 + 153 WP_001387489.1 Hok/Gef family protein Toxin
P8I10_RS07755 (1605040) 1605040..1605291 - 252 WP_001291964.1 hypothetical protein -
P8I10_RS07760 (1605792) 1605792..1605887 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
P8I10_RS07765 (1605952) 1605952..1606128 - 177 WP_001054897.1 hypothetical protein -
P8I10_RS07770 (1606520) 1606520..1606729 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
P8I10_RS07775 (1606801) 1606801..1607463 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
P8I10_RS07780 (1607534) 1607534..1609702 - 2169 WP_058649949.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-65 - 1541294..1643693 102399


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T275580 WP_001387489.1 NZ_CP121070:1604816-1604968 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

>T275580 NZ_CP121070:1604816-1604968 [Salmonella enterica subsp. enterica serovar Infantis]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA

Antitoxin


Download         Length: 61 bp

>AT275580 NZ_CP121070:c1604764-1604704 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References