Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4666000..4666602 | Replicon | chromosome |
Accession | NZ_CP121068 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | P8I08_RS22775 | Protein ID | WP_001159630.1 |
Coordinates | 4666291..4666602 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P8I08_RS22770 | Protein ID | WP_000362050.1 |
Coordinates | 4666000..4666290 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I08_RS22755 (4663493) | 4663493..4664395 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
P8I08_RS22760 (4664392) | 4664392..4665027 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
P8I08_RS22765 (4665024) | 4665024..4665953 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
P8I08_RS22770 (4666000) | 4666000..4666290 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
P8I08_RS22775 (4666291) | 4666291..4666602 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
P8I08_RS22780 (4666820) | 4666820..4667749 | + | 930 | WP_021294279.1 | alpha/beta hydrolase | - |
P8I08_RS22785 (4667835) | 4667835..4668146 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
P8I08_RS22790 (4668143) | 4668143..4668589 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
P8I08_RS22795 (4668604) | 4668604..4669545 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
P8I08_RS22800 (4669590) | 4669590..4670027 | - | 438 | WP_023993693.1 | D-aminoacyl-tRNA deacylase | - |
P8I08_RS22805 (4670024) | 4670024..4670896 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
P8I08_RS22810 (4670890) | 4670890..4671489 | - | 600 | WP_000965698.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T275569 WP_001159630.1 NZ_CP121068:c4666602-4666291 [Salmonella enterica subsp. enterica serovar Infantis]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10971.59 Da Isoelectric Point: 10.6525
>AT275569 WP_000362050.1 NZ_CP121068:c4666290-4666000 [Salmonella enterica subsp. enterica serovar Infantis]
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
MDKVLFERLTQSMSQMNEIIEGTREPSRTFHIDAMKIKEIRQASGLSQSKFAELISVNVDTLRNWEQGRRSPTGPAKALL
RAIANDPRNVIQALRY
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|