Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1610641..1610905 Replicon chromosome
Accession NZ_CP121068
Organism Salmonella enterica subsp. enterica serovar Infantis strain R21.1575

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag P8I08_RS07780 Protein ID WP_001387489.1
Coordinates 1610753..1610905 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 1610641..1610701 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I08_RS07765 (1606743) 1606743..1607813 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
P8I08_RS07770 (1607832) 1607832..1609040 - 1209 WP_001383960.1 IncI1-type conjugal transfer protein TrbA -
P8I08_RS07775 (1609347) 1609347..1610126 - 780 WP_275450201.1 protein FinQ -
- (1610641) 1610641..1610701 - 61 NuclAT_1 - Antitoxin
- (1610641) 1610641..1610701 - 61 NuclAT_1 - Antitoxin
- (1610641) 1610641..1610701 - 61 NuclAT_1 - Antitoxin
- (1610641) 1610641..1610701 - 61 NuclAT_1 - Antitoxin
P8I08_RS07780 (1610753) 1610753..1610905 + 153 WP_001387489.1 Hok/Gef family protein Toxin
P8I08_RS07785 (1610977) 1610977..1611228 - 252 WP_001291964.1 hypothetical protein -
P8I08_RS07790 (1611729) 1611729..1611824 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
P8I08_RS07795 (1611889) 1611889..1612065 - 177 WP_001054897.1 hypothetical protein -
P8I08_RS07800 (1612457) 1612457..1612666 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
P8I08_RS07805 (1612738) 1612738..1613400 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
P8I08_RS07810 (1613471) 1613471..1615639 - 2169 WP_058649949.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element blaCTX-M-65 - 1548059..1649630 101571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T275559 WP_001387489.1 NZ_CP121068:1610753-1610905 [Salmonella enterica subsp. enterica serovar Infantis]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT275559 NZ_CP121068:c1610701-1610641 [Salmonella enterica subsp. enterica serovar Infantis]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References