Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4490185..4490939 | Replicon | chromosome |
| Accession | NZ_CP121003 | ||
| Organism | Salmonella enterica strain 31A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | P6590_RS21815 | Protein ID | WP_000558168.1 |
| Coordinates | 4490185..4490496 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P6590_RS21820 | Protein ID | WP_001259009.1 |
| Coordinates | 4490493..4490939 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6590_RS21785 (4485843) | 4485843..4486745 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P6590_RS21790 (4486742) | 4486742..4487377 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P6590_RS21795 (4487374) | 4487374..4488303 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| P6590_RS21800 (4488350) | 4488350..4488640 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P6590_RS21805 (4488641) | 4488641..4488952 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P6590_RS21810 (4489170) | 4489170..4490099 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| P6590_RS21815 (4490185) | 4490185..4490496 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P6590_RS21820 (4490493) | 4490493..4490939 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P6590_RS21825 (4490954) | 4490954..4491895 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P6590_RS21830 (4491940) | 4491940..4492377 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| P6590_RS21835 (4492374) | 4492374..4493246 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P6590_RS21840 (4493240) | 4493240..4493839 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P6590_RS21845 (4494030) | 4494030..4494833 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P6590_RS21850 (4494867) | 4494867..4495763 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T275531 WP_000558168.1 NZ_CP121003:4490185-4490496 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT275531 WP_001259009.1 NZ_CP121003:4490493-4490939 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|