Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2443698..2443923 | Replicon | chromosome |
Accession | NZ_CP121003 | ||
Organism | Salmonella enterica strain 31A |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | P6590_RS11885 | Protein ID | WP_000813254.1 |
Coordinates | 2443698..2443853 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2443865..2443923 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6590_RS11850 | 2438805..2439086 | - | 282 | WP_000445513.1 | phage holin family protein | - |
P6590_RS11855 | 2439076..2439264 | - | 189 | WP_001688615.1 | putative holin | - |
P6590_RS11860 | 2439258..2439581 | - | 324 | Protein_2322 | tellurite/colicin resistance protein | - |
P6590_RS11865 | 2441752..2442288 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
P6590_RS11870 | 2442285..2442575 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
P6590_RS11875 | 2442575..2443174 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
P6590_RS11880 | 2443237..2443407 | - | 171 | WP_000734094.1 | hypothetical protein | - |
P6590_RS11885 | 2443698..2443853 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2443865..2443923 | + | 59 | - | - | Antitoxin |
P6590_RS11890 | 2444280..2445212 | + | 933 | WP_000556390.1 | hypothetical protein | - |
P6590_RS11895 | 2445209..2445763 | + | 555 | WP_001033796.1 | hypothetical protein | - |
P6590_RS11900 | 2445925..2446254 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
P6590_RS11905 | 2446298..2446345 | - | 48 | Protein_2331 | hypothetical protein | - |
P6590_RS11910 | 2446527..2446994 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
P6590_RS11915 | 2447379..2447534 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
P6590_RS11920 | 2447642..2448163 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
P6590_RS11925 | 2448601..2448822 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2438263..2450134 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T275518 WP_000813254.1 NZ_CP121003:c2443853-2443698 [Salmonella enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT275518 NZ_CP121003:2443865-2443923 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|