Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 91281..91932 | Replicon | plasmid pXJ22MSE2-1 |
| Accession | NZ_CP120975 | ||
| Organism | Moellerella wisconsensis strain XJ22MSE2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A857SB97 |
| Locus tag | P8A16_RS16240 | Protein ID | WP_042847389.1 |
| Coordinates | 91582..91932 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P8A16_RS16235 | Protein ID | WP_277850713.1 |
| Coordinates | 91281..91580 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A16_RS16205 | 87590..87799 | + | 210 | WP_042847397.1 | hypothetical protein | - |
| P8A16_RS16210 | 87876..88190 | + | 315 | WP_042847396.1 | hypothetical protein | - |
| P8A16_RS16215 | 88464..88682 | + | 219 | WP_042847394.1 | hypothetical protein | - |
| P8A16_RS16220 | 88716..89240 | + | 525 | WP_052219403.1 | hypothetical protein | - |
| P8A16_RS16225 | 89672..90073 | + | 402 | WP_042847392.1 | hypothetical protein | - |
| P8A16_RS16230 | 90124..91140 | - | 1017 | WP_042847391.1 | hypothetical protein | - |
| P8A16_RS16235 | 91281..91580 | - | 300 | WP_277850713.1 | XRE family transcriptional regulator | Antitoxin |
| P8A16_RS16240 | 91582..91932 | - | 351 | WP_042847389.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8A16_RS16245 | 92117..92695 | + | 579 | WP_067423959.1 | recombinase family protein | - |
| P8A16_RS16250 | 92772..94028 | + | 1257 | WP_277865244.1 | hypothetical protein | - |
| P8A16_RS16255 | 94284..94619 | + | 336 | WP_067423974.1 | PerC family transcriptional regulator | - |
| P8A16_RS16260 | 94697..95086 | + | 390 | WP_067423972.1 | hypothetical protein | - |
| P8A16_RS16265 | 95115..95819 | + | 705 | WP_137022593.1 | hypothetical protein | - |
| P8A16_RS16270 | 95834..96364 | + | 531 | WP_067423968.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa | - | 1..325400 | 325400 | |
| - | flank | IS/Tn | - | - | 92117..92695 | 578 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13437.50 Da Isoelectric Point: 5.2661
>T275502 WP_042847389.1 NZ_CP120975:c91932-91582 [Moellerella wisconsensis]
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK
MWEILTRDLFDSWFEEQNEETQIEVLAVLMILREDGPNLGRPQVDTLKGSQFPNMKELRIQVGGHPIRACFAFDPIRRGI
VLCAGDKKGKDETRFYKKLIKMADAEYAAHLLEQEK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|