Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 4725539..4725951 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | P7249_RS23805 | Protein ID | WP_000132630.1 |
Coordinates | 4725610..4725951 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4725539..4725615 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS23795 (4722166) | 4722166..4723635 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
P7249_RS23800 (4723635) | 4723635..4725389 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_15 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_16 | - | Antitoxin |
- (4725539) | 4725539..4725615 | - | 77 | NuclAT_16 | - | Antitoxin |
P7249_RS23805 (4725610) | 4725610..4725951 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
P7249_RS23810 (4725998) | 4725998..4727161 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
P7249_RS23815 (4727209) | 4727209..4728090 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
P7249_RS23820 (4728233) | 4728233..4728385 | - | 153 | WP_001418365.1 | hypothetical protein | - |
P7249_RS23825 (4728528) | 4728528..4729940 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 4717738..4738965 | 21227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T275461 WP_000132630.1 NZ_CP120944:4725610-4725951 [Escherichia coli O157:H7 str. EDL933]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT275461 NZ_CP120944:c4725615-4725539 [Escherichia coli O157:H7 str. EDL933]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|