Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4374203..4374897 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | P7249_RS22195 | Protein ID | WP_001263495.1 |
Coordinates | 4374203..4374601 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | P7249_RS22200 | Protein ID | WP_000554757.1 |
Coordinates | 4374604..4374897 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (4369790) | 4369790..4369870 | - | 81 | NuclAT_12 | - | - |
- (4369790) | 4369790..4369870 | - | 81 | NuclAT_12 | - | - |
- (4369790) | 4369790..4369870 | - | 81 | NuclAT_12 | - | - |
- (4369790) | 4369790..4369870 | - | 81 | NuclAT_12 | - | - |
P7249_RS22170 (4370466) | 4370466..4370924 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
P7249_RS22175 (4371185) | 4371185..4372642 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
P7249_RS22180 (4372699) | 4372699..4373220 | - | 522 | Protein_4348 | peptide chain release factor H | - |
P7249_RS22185 (4373219) | 4373219..4373422 | - | 204 | Protein_4349 | RtcB family protein | - |
P7249_RS22190 (4373741) | 4373741..4374193 | - | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
P7249_RS22195 (4374203) | 4374203..4374601 | - | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
P7249_RS22200 (4374604) | 4374604..4374897 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
P7249_RS22205 (4374949) | 4374949..4376004 | - | 1056 | WP_001226188.1 | DNA polymerase IV | - |
P7249_RS22210 (4376075) | 4376075..4376860 | - | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
P7249_RS22215 (4376832) | 4376832..4378544 | + | 1713 | Protein_4355 | flagellar biosynthesis protein FlhA | - |
P7249_RS22220 (4378689) | 4378689..4379186 | - | 498 | Protein_4356 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T275459 WP_001263495.1 NZ_CP120944:c4374601-4374203 [Escherichia coli O157:H7 str. EDL933]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|