Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2413745..2414216 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | P7249_RS12055 | Protein ID | WP_001303511.1 |
Coordinates | 2413745..2414023 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | P7249_RS12060 | Protein ID | WP_001302048.1 |
Coordinates | 2414025..2414216 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS12025 (2408970) | 2408970..2409221 | - | 252 | WP_000005552.1 | excisionase family protein | - |
P7249_RS12030 (2409294) | 2409294..2411765 | - | 2472 | WP_000048458.1 | exonuclease | - |
P7249_RS12035 (2411858) | 2411858..2412049 | - | 192 | WP_001090200.1 | DUF1482 family protein | - |
P7249_RS12040 (2412046) | 2412046..2412234 | - | 189 | WP_000449192.1 | cell division inhibition protein DicB | - |
P7249_RS12045 (2412803) | 2412803..2413021 | - | 219 | WP_001171930.1 | protein YdfC | - |
P7249_RS12050 (2413093) | 2413093..2413392 | - | 300 | WP_001240334.1 | hypothetical protein | - |
P7249_RS12055 (2413745) | 2413745..2414023 | - | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7249_RS12060 (2414025) | 2414025..2414216 | - | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
P7249_RS12065 (2414237) | 2414237..2414608 | - | 372 | WP_001169686.1 | hypothetical protein | - |
P7249_RS12070 (2414706) | 2414706..2415008 | + | 303 | WP_000172738.1 | transcriptional regulator | - |
P7249_RS12075 (2415005) | 2415005..2415430 | + | 426 | WP_000693943.1 | toxin YdaT family protein | - |
P7249_RS12080 (2415453) | 2415453..2416415 | + | 963 | WP_000095669.1 | helix-turn-helix domain-containing protein | - |
P7249_RS12085 (2416422) | 2416422..2417162 | + | 741 | WP_000788938.1 | ATP-binding protein | - |
P7249_RS12090 (2417188) | 2417188..2417957 | + | 770 | Protein_2366 | DUF1627 domain-containing protein | - |
P7249_RS12095 (2417973) | 2417973..2418368 | + | 396 | WP_001118159.1 | DUF977 family protein | - |
P7249_RS12100 (2418425) | 2418425..2419009 | + | 585 | WP_000206793.1 | DUF551 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | nleA/espI | 2398865..2455446 | 56581 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T275451 WP_001303511.1 NZ_CP120944:c2414023-2413745 [Escherichia coli O157:H7 str. EDL933]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|