Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 695876..696603 | Replicon | chromosome |
| Accession | NZ_CP120944 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | P7249_RS03475 | Protein ID | WP_000550189.1 |
| Coordinates | 695876..696190 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P7249_RS03480 | Protein ID | WP_000560249.1 |
| Coordinates | 696187..696603 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7249_RS03455 (692034) | 692034..693020 | - | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
| P7249_RS03460 (693099) | 693099..693791 | - | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
| P7249_RS03465 (693868) | 693868..694371 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| P7249_RS03470 (694456) | 694456..695592 | + | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| P7249_RS03475 (695876) | 695876..696190 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| P7249_RS03480 (696187) | 696187..696603 | + | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| P7249_RS03485 (696648) | 696648..698666 | - | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| P7249_RS03490 (699192) | 699192..701543 | - | 2352 | WP_000695517.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T275444 WP_000550189.1 NZ_CP120944:695876-696190 [Escherichia coli O157:H7 str. EDL933]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT275444 WP_000560249.1 NZ_CP120944:696187-696603 [Escherichia coli O157:H7 str. EDL933]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|