Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4002909..4003506 | Replicon | chromosome |
| Accession | NZ_CP120847 | ||
| Organism | Klebsiella pneumoniae strain KPHRJ | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | P5D18_RS19570 | Protein ID | WP_004142563.1 |
| Coordinates | 4003189..4003506 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | P5D18_RS19565 | Protein ID | WP_004142561.1 |
| Coordinates | 4002909..4003196 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5D18_RS19535 (3998989) | 3998989..3999237 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
| P5D18_RS19540 (3999255) | 3999255..3999596 | - | 342 | WP_025403994.1 | RamA family antibiotic efflux transcriptional regulator | - |
| P5D18_RS19545 (3999627) | 3999627..4000742 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
| P5D18_RS19550 (4000922) | 4000922..4001503 | + | 582 | WP_215402451.1 | TetR/AcrR family transcriptional regulator | - |
| P5D18_RS19555 (4001503) | 4001503..4001871 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
| P5D18_RS19560 (4001991) | 4001991..4002644 | + | 654 | WP_032419263.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| P5D18_RS19565 (4002909) | 4002909..4003196 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P5D18_RS19570 (4003189) | 4003189..4003506 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P5D18_RS19575 (4003691) | 4003691..4004734 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
| P5D18_RS19580 (4005404) | 4005404..4006270 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| P5D18_RS19585 (4006379) | 4006379..4007806 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T275423 WP_004142563.1 NZ_CP120847:c4003506-4003189 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |