Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 356402..356988 Replicon chromosome
Accession NZ_CP120847
Organism Klebsiella pneumoniae strain KPHRJ

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag P5D18_RS01675 Protein ID WP_002920800.1
Coordinates 356620..356988 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag P5D18_RS01670 Protein ID WP_004174006.1
Coordinates 356402..356623 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5D18_RS01650 (352559) 352559..353485 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P5D18_RS01655 (353482) 353482..354759 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
P5D18_RS01660 (354756) 354756..355523 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P5D18_RS01665 (355525) 355525..356238 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P5D18_RS01670 (356402) 356402..356623 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P5D18_RS01675 (356620) 356620..356988 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P5D18_RS01680 (357261) 357261..358577 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P5D18_RS01685 (358684) 358684..359571 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P5D18_RS01690 (359568) 359568..360413 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P5D18_RS01695 (360415) 360415..361485 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 353482..362222 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T275415 WP_002920800.1 NZ_CP120847:356620-356988 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT275415 WP_004174006.1 NZ_CP120847:356402-356623 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References