Detailed information of TA system TA275398

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2443702..2443927
• Replicon: chromosome
• Accession: NZ_CP120837
• Organism: Salmonella enterica subsp. enterica strain 21A

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: P4B21_RS11885
• Protein ID: WP_000813254.1
• Coordinates: 2443702..2443857 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2443869..2443927 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P4B21_RS11850	2438809..2439090	-	282	WP_000445513.1	phage holin family protein	-
P4B21_RS11855	2439080..2439268	-	189	WP_001688615.1	putative holin	-
P4B21_RS11860	2439262..2439585	-	324	Protein_2322	tellurite/colicin resistance protein	-
P4B21_RS11865	2441756..2442292	-	537	WP_000640113.1	DUF1133 family protein	-
P4B21_RS11870	2442289..2442579	-	291	WP_000774470.1	DUF1364 domain-containing protein	-
P4B21_RS11875	2442579..2443178	-	600	WP_000940751.1	DUF1367 family protein	-
P4B21_RS11880	2443241..2443411	-	171	WP_000734094.1	hypothetical protein	-
P4B21_RS11885	2443702..2443857	-	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
-	2443869..2443927	+	59	-	-	Antitoxin
P4B21_RS11890	2444284..2445216	+	933	WP_000556390.1	hypothetical protein	-
P4B21_RS11895	2445213..2445767	+	555	WP_001033796.1	hypothetical protein	-
P4B21_RS11900	2445929..2446258	-	330	WP_001676916.1	DUF977 family protein	-
P4B21_RS11905	2446302..2446349	-	48	Protein_2331	hypothetical protein	-
P4B21_RS11910	2446531..2446998	+	468	WP_001227859.1	helix-turn-helix domain-containing protein	-
P4B21_RS11915	2447383..2447538	+	156	WP_085981757.1	DUF1391 family protein	-
P4B21_RS11920	2447646..2448167	-	522	WP_000004762.1	super-infection exclusion protein B	-
P4B21_RS11925	2448605..2448826	+	222	WP_000560208.1	cell division protein FtsZ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2438267..2450138	11871

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T275398 WP_000813254.1 NZ_CP120837:c2443857-2443702 [Salmonella enterica subsp. enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT275398 NZ_CP120837:2443869-2443927 [Salmonella enterica subsp. enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin