Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 835941..836566 | Replicon | chromosome |
Accession | NZ_CP120837 | ||
Organism | Salmonella enterica subsp. enterica strain 21A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | P4B21_RS04030 | Protein ID | WP_000911336.1 |
Coordinates | 836168..836566 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | P4B21_RS04025 | Protein ID | WP_000557549.1 |
Coordinates | 835941..836168 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B21_RS03995 (830949) | 830949..832466 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
P4B21_RS04000 (832542) | 832542..833087 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
P4B21_RS04005 (833352) | 833352..834110 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
P4B21_RS04015 (834395) | 834395..835201 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
P4B21_RS04020 (835481) | 835481..835732 | - | 252 | WP_001576352.1 | hypothetical protein | - |
P4B21_RS04025 (835941) | 835941..836168 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P4B21_RS04030 (836168) | 836168..836566 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P4B21_RS04035 (837374) | 837374..837910 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
P4B21_RS04040 (837957) | 837957..838589 | + | 633 | WP_000835265.1 | YfdX family protein | - |
P4B21_RS04045 (839308) | 839308..839889 | + | 582 | WP_001244651.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 834395..845750 | 11355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T275396 WP_000911336.1 NZ_CP120837:836168-836566 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2Y5V5 |