Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | bsrE-as-bsrE/- |
Location | 1434610..1434856 | Replicon | chromosome |
Accession | NZ_CP120681 | ||
Organism | Bacillus subtilis strain DSM 10 |
Toxin (Protein)
Gene name | bsrE | Uniprot ID | - |
Locus tag | P5655_RS07510 | Protein ID | WP_109789044.1 |
Coordinates | 1434610..1434702 (+) | Length | 31 a.a. |
Antitoxin (RNA)
Gene name | as-bsrE | ||
Locus tag | - | ||
Coordinates | 1434683..1434856 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5655_RS07495 | 1429770..1430105 | + | 336 | WP_009967409.1 | hypothetical protein | - |
P5655_RS07500 | 1430152..1433736 | - | 3585 | WP_277723653.1 | P-loop NTPase fold protein | - |
P5655_RS07505 | 1433989..1434321 | - | 333 | WP_026009814.1 | hypothetical protein | - |
P5655_RS07510 | 1434610..1434702 | + | 93 | WP_109789044.1 | type I toxin-antitoxin system toxin BsrE | Toxin |
- | 1434683..1434856 | - | 174 | - | - | Antitoxin |
P5655_RS07515 | 1434971..1435813 | - | 843 | WP_003231327.1 | hypothetical protein | - |
P5655_RS07520 | 1436013..1436471 | - | 459 | WP_003231326.1 | type VII secretion system immunity protein YobK | - |
P5655_RS07525 | 1436481..1438283 | - | 1803 | WP_004399481.1 | LXG family T7SS effector ribonuclease toxin YobL | - |
P5655_RS07530 | 1438385..1438942 | - | 558 | WP_004399321.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1421006..1444273 | 23267 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 31 a.a. Molecular weight: 3358.16 Da Isoelectric Point: 4.1840
>T275350 WP_109789044.1 NZ_CP120681:1434610-1434702 [Bacillus subtilis]
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
MSTFQALMLMLAIGSFIIALLTYIEKIDLP
Download Length: 93 bp
Antitoxin
Download Length: 174 bp
>AT275350 NZ_CP120681:c1434856-1434683 [Bacillus subtilis]
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
TTACAATACATTACAGTGCATTTCTTTAATGAGAAATGCATAAAATAAAAAAGACCGAGGTGCTACCAACACCCCGGCTC
TGTACAAAAAGTTGCCCATCAAAGGGCTTGCTCGATGTGGTTCTAGGTAGGCCTATCCCTTCAGGTTCTGAGGCTCAAGG
GAGGTCTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|