275334

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 1628105..1628859 Replicon chromosome
Accession NZ_CP120671
Organism Salmonella enterica strain SC2020597

Toxin (Protein)


Gene name higB Uniprot ID A0A5I4V816
Locus tag P4B13_RS07715 Protein ID WP_017465947.1
Coordinates 1628548..1628859 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag P4B13_RS07710 Protein ID WP_017465948.1
Coordinates 1628105..1628551 (-) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4B13_RS07680 (1623281) 1623281..1624177 + 897 WP_001520529.1 sugar kinase -
P4B13_RS07685 (1624211) 1624211..1625014 + 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
P4B13_RS07690 (1625205) 1625205..1625804 + 600 WP_001621364.1 glucose-1-phosphatase -
P4B13_RS07695 (1625798) 1625798..1626670 + 873 WP_000921423.1 virulence factor BrkB family protein -
P4B13_RS07700 (1626667) 1626667..1627104 + 438 WP_000560974.1 D-aminoacyl-tRNA deacylase -
P4B13_RS07705 (1627149) 1627149..1628090 + 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
P4B13_RS07710 (1628105) 1628105..1628551 - 447 WP_017465948.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
P4B13_RS07715 (1628548) 1628548..1628859 - 312 WP_017465947.1 type II toxin-antitoxin system HigB family toxin Toxin
P4B13_RS07720 (1628945) 1628945..1629874 - 930 WP_001127708.1 alpha/beta hydrolase -
P4B13_RS07725 (1630092) 1630092..1630403 + 312 WP_001159635.1 cytotoxic translational repressor of toxin-antitoxin stability system -
P4B13_RS07730 (1630404) 1630404..1630694 + 291 WP_000362050.1 DNA-binding transcriptional regulator -
P4B13_RS07735 (1630741) 1630741..1631670 - 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
P4B13_RS07740 (1631667) 1631667..1632302 - 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
P4B13_RS07745 (1632299) 1632299..1633201 - 903 WP_000331364.1 formate dehydrogenase subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(A) / dfrA12 / aadA2 / qacE / sul1 / sul4 / mph(E) / msr(E) / mph(A) / blaDHA-1 / qnrB4 / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / sul2 / aph(3'')-Ib / aph(6)-Id / floR - 1599852..2011007 411155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12384.31 Da        Isoelectric Point: 9.2528

>T275334 WP_017465947.1 NZ_CP120671:c1628859-1628548 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16736.06 Da        Isoelectric Point: 6.6451

>AT275334 WP_017465948.1 NZ_CP120671:c1628551-1628105 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKSLN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I4V816

Antitoxin

Source ID Structure

References