Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 401907..402494 | Replicon | chromosome |
Accession | NZ_CP120638 | ||
Organism | Rhizobium sp. 32-5/1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | P6U16_RS02040 | Protein ID | WP_277702432.1 |
Coordinates | 402213..402494 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | P6U16_RS02035 | Protein ID | WP_277702431.1 |
Coordinates | 401907..402203 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6U16_RS02005 (P6U16_02005) | 397629..398654 | - | 1026 | WP_277702425.1 | tRNA dihydrouridine synthase DusB | - |
P6U16_RS02010 (P6U16_02010) | 398839..400050 | + | 1212 | WP_277702426.1 | bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | - |
P6U16_RS02015 (P6U16_02015) | 400047..400550 | + | 504 | WP_277702427.1 | CinA family protein | - |
P6U16_RS02020 (P6U16_02020) | 400551..401156 | - | 606 | WP_277702428.1 | hypothetical protein | - |
P6U16_RS02025 (P6U16_02025) | 401129..401383 | - | 255 | WP_277702429.1 | hypothetical protein | - |
P6U16_RS02030 (P6U16_02030) | 401448..401900 | - | 453 | WP_277702430.1 | type II toxin-antitoxin system RatA family toxin | - |
P6U16_RS02035 (P6U16_02035) | 401907..402203 | - | 297 | WP_277702431.1 | HigA family addiction module antitoxin | Antitoxin |
P6U16_RS02040 (P6U16_02040) | 402213..402494 | - | 282 | WP_277702432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6U16_RS02045 (P6U16_02045) | 402531..403508 | - | 978 | WP_277702433.1 | lipoyl synthase | - |
P6U16_RS02050 (P6U16_02050) | 403592..405036 | - | 1445 | Protein_399 | dihydrolipoyl dehydrogenase | - |
P6U16_RS02055 (P6U16_02055) | 405029..405637 | - | 609 | WP_277702434.1 | GNAT family N-acetyltransferase | - |
P6U16_RS02060 (P6U16_02060) | 405639..406280 | - | 642 | WP_277702435.1 | SGNH/GDSL hydrolase family protein | - |
P6U16_RS02065 (P6U16_02065) | 406285..406800 | - | 516 | WP_277702436.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10867.44 Da Isoelectric Point: 10.0216
>T275314 WP_277702432.1 NZ_CP120638:c402494-402213 [Rhizobium sp. 32-5/1]
MIKGFRNKETEILFRSNGRSRFPPDIVPRARRKLLVLDAAFKLADVTVPPSNRLELLSGNRQGQHSIRINDQWRICFVWD
NGHAHEVEICDYH
MIKGFRNKETEILFRSNGRSRFPPDIVPRARRKLLVLDAAFKLADVTVPPSNRLELLSGNRQGQHSIRINDQWRICFVWD
NGHAHEVEICDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|