Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4630671..4631350 | Replicon | chromosome |
Accession | NZ_CP120633 | ||
Organism | Escherichia coli strain USVAST219 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | P6O79_RS22605 | Protein ID | WP_000057523.1 |
Coordinates | 4630671..4630973 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | P6O79_RS22610 | Protein ID | WP_000806442.1 |
Coordinates | 4631009..4631350 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6O79_RS22580 (4626047) | 4626047..4627699 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
P6O79_RS22585 (4627737) | 4627737..4628240 | - | 504 | WP_000667000.1 | hypothetical protein | - |
P6O79_RS22590 (4628237) | 4628237..4628893 | - | 657 | WP_015674862.1 | hypothetical protein | - |
P6O79_RS22595 (4629061) | 4629061..4629540 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
P6O79_RS22600 (4629744) | 4629744..4630538 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
P6O79_RS22605 (4630671) | 4630671..4630973 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6O79_RS22610 (4631009) | 4631009..4631350 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
P6O79_RS22615 (4631408) | 4631408..4633912 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
P6O79_RS22620 (4634174) | 4634174..4635106 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T275310 WP_000057523.1 NZ_CP120633:4630671-4630973 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|