Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4110021..4110279 | Replicon | chromosome |
Accession | NZ_CP120633 | ||
Organism | Escherichia coli strain USVAST219 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | P6O79_RS20150 | Protein ID | WP_000809168.1 |
Coordinates | 4110021..4110173 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4110222..4110279 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6O79_RS20130 | 4105268..4105981 | - | 714 | WP_001102393.1 | acidic protein MsyB | - |
P6O79_RS20135 | 4106007..4106411 | - | 405 | WP_000843689.1 | DUF2541 family protein | - |
P6O79_RS20140 | 4106782..4108698 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
P6O79_RS20145 | 4108787..4109917 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
P6O79_RS20150 | 4110021..4110173 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 4110222..4110279 | + | 58 | - | - | Antitoxin |
P6O79_RS20155 | 4110787..4111548 | + | 762 | WP_001274833.1 | outer membrane protein OmpK | - |
P6O79_RS20160 | 4111569..4113062 | + | 1494 | WP_001173016.1 | sulfatase-like hydrolase/transferase | - |
P6O79_RS20165 | 4113191..4114450 | + | 1260 | WP_000494928.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T275306 WP_000809168.1 NZ_CP120633:c4110173-4110021 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT275306 NZ_CP120633:4110222-4110279 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|