Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3480126..3480728 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | P6O79_RS17290 | Protein ID | WP_000897302.1 |
| Coordinates | 3480126..3480437 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P6O79_RS17295 | Protein ID | WP_000356397.1 |
| Coordinates | 3480438..3480728 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS17265 (3476040) | 3476040..3476639 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| P6O79_RS17270 (3476633) | 3476633..3477505 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| P6O79_RS17275 (3477502) | 3477502..3477939 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| P6O79_RS17280 (3477984) | 3477984..3478925 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| P6O79_RS17285 (3478989) | 3478989..3479897 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| P6O79_RS17290 (3480126) | 3480126..3480437 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| P6O79_RS17295 (3480438) | 3480438..3480728 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| P6O79_RS17300 (3481087) | 3481087..3481365 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| P6O79_RS17305 (3481762) | 3481762..3481980 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| P6O79_RS17310 (3482165) | 3482165..3482905 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| P6O79_RS17315 (3482930) | 3482930..3483778 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| P6O79_RS17320 (3484068) | 3484068..3484310 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| P6O79_RS17325 (3484492) | 3484492..3485421 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T275303 WP_000897302.1 NZ_CP120633:3480126-3480437 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|