Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2605807..2606606 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | P6O79_RS13040 | Protein ID | WP_000347251.1 |
| Coordinates | 2606142..2606606 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | P6O79_RS13035 | Protein ID | WP_001296435.1 |
| Coordinates | 2605807..2606142 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS13020 (2601592) | 2601592..2602362 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| P6O79_RS13025 (2602378) | 2602378..2603712 | - | 1335 | WP_277715573.1 | galactarate/glucarate/glycerate transporter GarP | - |
| P6O79_RS13030 (2604087) | 2604087..2605658 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| P6O79_RS13035 (2605807) | 2605807..2606142 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| P6O79_RS13040 (2606142) | 2606142..2606606 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| P6O79_RS13045 (2606661) | 2606661..2607470 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| P6O79_RS13050 (2607719) | 2607719..2608999 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| P6O79_RS13055 (2609022) | 2609022..2609495 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| P6O79_RS13060 (2609506) | 2609506..2610285 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| P6O79_RS13065 (2610275) | 2610275..2611153 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| P6O79_RS13070 (2611171) | 2611171..2611605 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T275300 WP_000347251.1 NZ_CP120633:2606142-2606606 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |