Detailed information of TA system TA275286

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokC/Ldr(toxin)
• Location: 474091..474312
• Replicon: chromosome
• Accession: NZ_CP120633
• Organism: Escherichia coli strain USVAST219

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: P6O79_RS02675
• Protein ID: WP_001531632.1
• Coordinates: 474091..474198 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokC
Locus tag	-
Coordinates	474246..474312 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P6O79_RS02650 (469935)	469935..471017	+	1083	WP_000804726.1	peptide chain release factor 1	-
P6O79_RS02655 (471017)	471017..471850	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
P6O79_RS02660 (471847)	471847..472239	+	393	WP_000200375.1	invasion regulator SirB2	-
P6O79_RS02665 (472243)	472243..473052	+	810	WP_001257044.1	invasion regulator SirB1	-
P6O79_RS02670 (473088)	473088..473942	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
P6O79_RS02675 (474091)	474091..474198	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (474248)	474248..474311	+	64	NuclAT_12	-	-
- (474248)	474248..474311	+	64	NuclAT_12	-	-
- (474248)	474248..474311	+	64	NuclAT_12	-	-
- (474248)	474248..474311	+	64	NuclAT_12	-	-
- (474248)	474248..474311	+	64	NuclAT_13	-	-
- (474248)	474248..474311	+	64	NuclAT_13	-	-
- (474248)	474248..474311	+	64	NuclAT_13	-	-
- (474248)	474248..474311	+	64	NuclAT_13	-	-
- (474248)	474248..474311	+	64	NuclAT_14	-	-
- (474248)	474248..474311	+	64	NuclAT_14	-	-
- (474248)	474248..474311	+	64	NuclAT_14	-	-
- (474248)	474248..474311	+	64	NuclAT_14	-	-
- (474248)	474248..474311	+	64	NuclAT_15	-	-
- (474248)	474248..474311	+	64	NuclAT_15	-	-
- (474248)	474248..474311	+	64	NuclAT_15	-	-
- (474248)	474248..474311	+	64	NuclAT_15	-	-
- (474248)	474248..474311	+	64	NuclAT_16	-	-
- (474248)	474248..474311	+	64	NuclAT_16	-	-
- (474248)	474248..474311	+	64	NuclAT_16	-	-
- (474248)	474248..474311	+	64	NuclAT_16	-	-
- (474248)	474248..474311	+	64	NuclAT_17	-	-
- (474248)	474248..474311	+	64	NuclAT_17	-	-
- (474248)	474248..474311	+	64	NuclAT_17	-	-
- (474248)	474248..474311	+	64	NuclAT_17	-	-
- (474246)	474246..474312	+	67	NuclAT_10	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_10	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_10	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_10	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_5	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_5	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_5	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_5	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_6	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_6	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_6	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_6	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_7	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_7	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_7	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_7	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_8	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_8	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_8	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_8	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_9	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_9	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_9	-	Antitoxin
- (474246)	474246..474312	+	67	NuclAT_9	-	Antitoxin
- (474248)	474248..474313	+	66	NuclAT_18	-	-
- (474248)	474248..474313	+	66	NuclAT_18	-	-
- (474248)	474248..474313	+	66	NuclAT_18	-	-
- (474248)	474248..474313	+	66	NuclAT_18	-	-
- (474248)	474248..474313	+	66	NuclAT_19	-	-
- (474248)	474248..474313	+	66	NuclAT_19	-	-
- (474248)	474248..474313	+	66	NuclAT_19	-	-
- (474248)	474248..474313	+	66	NuclAT_19	-	-
- (474248)	474248..474313	+	66	NuclAT_20	-	-
- (474248)	474248..474313	+	66	NuclAT_20	-	-
- (474248)	474248..474313	+	66	NuclAT_20	-	-
- (474248)	474248..474313	+	66	NuclAT_20	-	-
- (474248)	474248..474313	+	66	NuclAT_21	-	-
- (474248)	474248..474313	+	66	NuclAT_21	-	-
- (474248)	474248..474313	+	66	NuclAT_21	-	-
- (474248)	474248..474313	+	66	NuclAT_21	-	-
- (474248)	474248..474313	+	66	NuclAT_22	-	-
- (474248)	474248..474313	+	66	NuclAT_22	-	-
- (474248)	474248..474313	+	66	NuclAT_22	-	-
- (474248)	474248..474313	+	66	NuclAT_22	-	-
- (474248)	474248..474313	+	66	NuclAT_23	-	-
- (474248)	474248..474313	+	66	NuclAT_23	-	-
- (474248)	474248..474313	+	66	NuclAT_23	-	-
- (474248)	474248..474313	+	66	NuclAT_23	-	-
P6O79_RS02680 (474603)	474603..475703	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
P6O79_RS02685 (475973)	475973..476212	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
P6O79_RS02690 (476361)	476361..477056	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
P6O79_RS02695 (477100)	477100..477453	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
P6O79_RS02700 (477638)	477638..479032	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T275286 WP_001531632.1 NZ_CP120633:c474198-474091 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT275286 NZ_CP120633:474246-474312 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin